Product details
| Product Overview | Recombinant Mouse Nog (homodimer) (P97466) partial protein expressed in E. coli. |
| Source | E. coli |
| Species | Mouse |
| Tag | None |
| Form | Lyophilized |
| AA Sequence | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| Applications | Func,SDS-PAGE |
| Buffer | Lyophilized from solutions contain no sodiun azide nor carrier protein. |
| Storage | Store at -20℃. Reconstitute in water to a concentration of 0. 1-1. 0 mg/mL. Due to solubility reasons the protein should be kept at low pH. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein |
| Official Symbol | Nog |
| Synonyms | - |
| Gene ID | 18121 |
| UniProt ID | P97466 |