Product details
| Product Overview | Recombinant Human HIST1H3F full-length ORF (ADR82713.1, 1 a.a. - 136 a.a.) protein with GST tag at N-terminal. |
| Species | Human |
| Tag | GST |
| AA Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Applications | AP,Array,ELISA,WB-Re |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage | Store at -80℃. Aliquot to avoid repeated freezing and thawing. |
| Notes | Best use within three months from the date of receipt of this protein. |
| Official Symbol | HIST1H3F |
| Synonyms | H3/i, H3FI |
| Gene ID | 8968 |
| mRNA Refseq | HQ257959.1 |
| Refseq | ADR82713.1 |